PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g039320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 1729aa    MW: 194398 Da    PI: 4.9396
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g039320.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1945100257
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      kR+  t+ qle+Le+++ +++yps+++r++L++kl+Lt+rq ++WF+ rR k+kk
  Csa17g039320.1  45 PKRQMKTPFQLETLEKVYSEEKYPSEATRADLSDKLNLTDRQLQMWFCHRRLKDKK 100
                     69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-1919102IPR009057Homeodomain-like
SuperFamilySSF466892.48E-1636101IPR009057Homeodomain-like
PROSITE profilePS5007116.53641101IPR001356Homeobox domain
SMARTSM003898.8E-1843105IPR001356Homeobox domain
PfamPF000467.4E-1745100IPR001356Homeobox domain
CDDcd000861.50E-1446100No hitNo description
SMARTSM005714.6E-24562621IPR018501DDT domain
PROSITE profilePS5082718.031562621IPR018501DDT domain
PfamPF027919.4E-18563618IPR018501DDT domain
PfamPF050669.1E-16744811IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156127.8E-7944985IPR028942WHIM1 domain
PfamPF156134.5E-1311191191IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1729 aa     Download sequence    Send to blast
MEMGSDEEED HQIRSVADGG GGGGGSSNNK KKNKIDNSSS SSAKPKRQMK TPFQLETLEK  60
VYSEEKYPSE ATRADLSDKL NLTDRQLQMW FCHRRLKDKK DDQSLSSKTP VKSAVPAVRP  120
PPPALASSVN DLPPSRSVPE QDSGSGSDSG SGCSPYSDSR RNFASGSSSS RAELDEYETM  180
GKPSYEPRLS AMVRRAIVCI EAQLGEPLRD DGPILGMEFD PLPPGAFGTP IAMQKHLLHP  240
YESKMYEPHD VRPRRSQAAA RSFHEQQSLD DPSSFTPEVY GRYSENHAHG MDYEIAHPRS  300
SSFMHENGSL PRSYGTPGYV SRNCSTSQQD MPSPIVASAH RGDRFLMEKD SSVLGTEDPY  360
MLSDGVRKSN DVHRKGKIHD VRLGRGSETR ENRGPKDLEK LEIQKKKNEE RMRKEMERNE  420
RERRKEEERL MRERIKEEER LQREQRREME RREKFLQREN ERAEKKKQKE EIRREKDAIR  480
RKIAIEKATA RRIAKESMDL IEDEQLELME LAAISKGLPS VLQLDHDTLQ NLELYRDSLS  540
TFPPKGLQLK MPFAISPWKD SDESVGNLLM VWRFLTSFSD VLDLWPFTLD EFIQAFHDYD  600
SRLLGEIHVT LLRSIIRDIE DVARTPFSGI GNNQYTTANP EGGHPQIVEG AYAWGFDIRS  660
WKKNLNSLTW PEVLRQLALS TGLGPRLKKK NSRLTHTGDK DEAKGCEDII STIRSGSAAE  720
SAFALMREKG LLAPRKSRHR LTPGTVKFAA FHVLSLEGSK GLTVLELADK IQKSGLRDLT  780
TSKTPEASIS VALTRDVKLF ERIAPSTYCV RAPYVKDPAD GETILADARK KIRAFESGLT  840
GPEDVNDLER DEDFEIDIDE DPEVDDLATL ASASKTADLG EANILSGKGG DTMFCDVKAG  900
VKSEIEKEFS SPLPSSIKSI VPQHNERLKD TAVGCVDAMV DESNEGQSWI QGLTEGDYCH  960
LSVEERLNAL VALVGIANEG NSIRAGLEDR MEAANSLKKQ MWAEAQLDNS CMRDVLKLDF  1020
QNLANSKTES TMGLPIIQSS NREKDNFDRD PSELLDETKP LEVVSNDLRQ SSADRGLINQ  1080
ESNISQENCS FQQGYASKRS RSQLKSYIGH KAEEVYPYRS LPVGQDRRHN RYWLFAASAS  1140
KSDPSSGLLF VELHDGKWLL IDSEEAFDTL VASLDMRGIR ESHLRIMLQK IEGSFKENAR  1200
KNMKLARNPF LKEKSVMNHS PTDSVSPSSA VSGSNSDSME TSNSIRVELG RNDTEKKSLS  1260
KRFHDFQRWM WTETYSSLPS CARKYGKKRS ELLATCALCV ASYLSEYTHC TSCHQRLDMV  1320
NGSEILDLGL TVSPLPFGVR LLKPLLVFLE ASIPDEALES FWTEDKRKMW GFRLNASSSP  1380
EELLQVLTTL ETAIKKEYLS SNFMSAKELL GVGDADADTW GSVDVLPWIP KTVSAVALRL  1440
SELDASIIYV KPEKPDLIPE DENEQISLFP GDSLFKGKGP REQEDQDEVV PNLGNRRSNK  1500
RARVSLGSGS NKKVKRKKAQ GGPNRFVVSR RNVAVDNNLM SMELNHQIPG RGKRTVRKRP  1560
ERINEDNDHL VNRMADIVRP KTQEIEEDEE EEEQTFRDID EDWAAGETPR EMDEDWANET  1620
PNRMMTPMQV DDESDNSVGV ESEDDDVDGQ FVDYSQRNKW GLDWNSNANE AAMEDEEEEE  1680
VVGVERVEGE DDAEMSESSE DDDDDVPANN AANNYDRESE GGYSSSDS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193100RRLKDKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0101550.0AC010155.3 Genomic sequence for Arabidopsis thaliana BAC F3M18 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478217.10.0PREDICTED: uncharacterized protein LOC104757188
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLD7KCW80.0D7KCW8_ARALL; HB-1
STRINGfgenesh2_kg.1__3015__AT1G28420.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83472236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1